PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00666.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 402aa    MW: 45435.2 Da    PI: 5.963
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00666.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.89.1e-081456339
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                             +r C+ + +k+++++C  ++ +lC++C  + H+       H++
  Rsa1.0_00666.1_g00004.1 14 ARACDSCVKKRARWYCAADDAFLCHSCDGSVHSAnplacrHER 56
                             578***************************9965777777776 PP

2CCT68.51.8e-23352395144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk++
  Rsa1.0_00666.1_g00004.1 352 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRS 395
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.3381259IPR000315B-box-type zinc finger
SMARTSM003362.2E-71259IPR000315B-box-type zinc finger
PfamPF006433.7E-61457IPR000315B-box-type zinc finger
CDDcd000213.15E-71559No hitNo description
PROSITE profilePS5101716.083352394IPR010402CCT domain
PfamPF062035.2E-18352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MMKSLANAVG GKTARACDSC VKKRARWYCA ADDAFLCHSC DGSVHSANPL ACRHERIRLK  60
TASAGKHRGD ASSSPPHPAT WHHGFTRKAR TPRGGKKSHT MVFHDLVPEM SSEDFEVEEQ  120
LIFEVPVLNP MGDEQCFKET KTVFPMMPVC FKSSEEEDDN TESCLNGLFL TEMELAQFSA  180
DVETLLGGGT DREFHAMEEL GLSEILKIEK EEVKEEEEFA TREVCDLDAG NETSPFEISF  240
DYESSHKTAL EEDDEKEDVM KNLVDVGVNE MSGRIKEEKK EKVLMLRLDY ETVISTWGSQ  300
GTPWTVLEPP EIDLDMLCCP TNSMGESGGE AHHHNHFRGL GLHMREAGDG GREARVSRYR  360
EKRRTRLFSK KIRYEVRKLN AEKRPRMKGR FVKRSSIAAA HQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1362378RRTRLFSKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649118.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like
RefseqXP_009105042.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X2
RefseqXP_009105041.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 6-like isoform X1
SwissprotQ8LG760.0COL6_ARATH; Zinc finger protein CONSTANS-LIKE 6
TrEMBLM4CIK10.0M4CIK1_BRARP; Uncharacterized protein
STRINGBra004035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68520.10.0B-box type zinc finger protein with CCT domain